HLA-DRB1 (NM_002124) Human Recombinant Protein

HLA-DRB1 protein,

Product Info Summary

SKU: PROTP01911
Size: 20 µg
Source: HEK293T

Product Name

HLA-DRB1 (NM_002124) Human Recombinant Protein

View all HLA-DRB1 recombinant proteins

SKU/Catalog Number

PROTP01911

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human major histocompatibility complex, class II, DR beta 1 (HLA-DRB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

HLA-DRB1 (NM_002124) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01911)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.966kDa

Amino Acid Sequence

MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For HLA-DRB1 (Source: Uniprot.org, NCBI)

Gene Name

HLA-DRB1

Full Name

HLA class II histocompatibility antigen, DRB1 beta chain

Weight

29.966kDa

Alternative Names

Clone P2-beta-3; DR1; DR-1; DR12; DR-12; DR13; DR-13; DR14; DR-14; DR16; DR-16; DR4; DR-4; DR5; DR-5; DR7; DR-7; DR8; DR-8; DR9; DR-9; DRB1; DRw10; DRw11; DRw8; DW2.2/DR2.2; FLJ75017; FLJ76359; HLA class II antigen beta chain; HLA class II histocompatibility antigen, DR-1 beta chain; HLA-DR1B; HLA-DRB; HLA-DRB1*; HLA-DRB2; HLA-DR-beta 1; human leucocyte antigen DRB1; leucocyte antigen DR beta 1 chain; leucocyte antigen DRB1; lymphocyte antigen DRB1; major histocompatibility complex, class II, DR beta 1; MHC class II antigen DRB1*1; MHC class II antigen DRB1*10; MHC class II antigen DRB1*11; MH HLA-DRB1 DRB1, HLA-DR1B, HLA-DRB, SS1 major histocompatibility complex, class II, DR beta 1 major histocompatibility complex, class II, DR beta 1 precursor|HLA class II histocompatibility antigen, DR-1 beta chain|MHC class II HLA-DR beta 1 chain|human leucocyte antigen DRB1|lymphocyte antigen DRB1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HLA-DRB1, check out the HLA-DRB1 Infographic

HLA-DRB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HLA-DRB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01911

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HLA-DRB1 (NM_002124) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review HLA-DRB1 (NM_002124) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HLA-DRB1 (NM_002124) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01911
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.